SysQuan Mouse Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
O35250	Exoc7	VLGNLQLNLLSK	Muscle	—	100.0	None	—
O35250	Exoc7	VTDYIAEK	BrainStem	—	100.0	None	—
O35250	Exoc7	VTDYIAEK	Cerebrum	—	100.0	None	—
O35250	Exoc7	VTDYIAEK	kidney	—	100.0	None	—
O35250	Exoc7	VTDYIAEK	liver	—	100.0	None	—
O35250	Exoc7	VTDYIAEK	lung	—	100.0	None	—
O35250	Exoc7	VYEDPALSAIFLHNNYNYILK	Cerebrum	—	100.0	None	—
O35250	Exoc7	VYEDPALSAIFLHNNYNYILK	lung	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	BrainStem	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	Cerebellum	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	Cerebrum	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	kidney	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	lung	—	100.0	None	—
O35250	Exoc7	YGSVPFTK	Spleen	—	100.0	None	—
O35261	E2f3	FIQLLSQSPDGVLDLNK	Cerebrum	—	100.0	None	—
O35286	Dhx15	DNQVVQLHPSTVLDHKPEWVLYNEFVLTTK	BoneMarrow	—	100.0	None	—
O35286	Dhx15	DNQVVQLHPSTVLDHKPEWVLYNEFVLTTK	BrainStem	—	100.0	None	—
O35286	Dhx15	DNQVVQLHPSTVLDHKPEWVLYNEFVLTTK	Thymus	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Bladder	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	BrainStem	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Cerebellum	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Cerebrum	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Heart	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	LargeIntestines	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	liver	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Muscle	—	100.0	None	—
O35286	Dhx15	EVDDLGPEVGDIK	Spleen	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	AdrenalGland	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Bladder	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	BoneMarrow	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	BrainStem	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Cerebellum	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Cerebrum	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Heart	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	kidney	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	liver	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	lung	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Muscle	—	100.0	None	—
O35286	Dhx15	FAHIDGDHLTLLNVYHAFK	Thymus	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	AdrenalGland	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	BrainStem	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	Cerebellum	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	Gallbladder	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	kidney	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	liver	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	lung	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	LymphNodes	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	Muscle	—	100.0	None	—
O35286	Dhx15	HQSFVLVGETGSGK	Thymus	—	100.0	None	—
O35286	Dhx15	IFEPPPPK	BrainStem	—	100.0	None	—

SysQuan Mouse Database

Cart (0)