SysQuan Mouse Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
E9Q2E4	Hectd4	IASLLLAK	lung	—	100.0	None	—
E9Q2E4	Hectd4	IPAPWAAGK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	IPAPWAAGK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	IPAPWAAGK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	LGVSHIITEPK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	LGVSHIITEPK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	LGVSHIITEPK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	LGVSHIITEPK	lung	—	100.0	None	—
E9Q2E4	Hectd4	LLSLLLDQRPSPK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	LLSLLLDQRPSPK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	LLSLLLDQRPSPK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	LNDELLHYILK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	LNDELLHYILK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	LSIFIHK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	LSIFIHK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	QLQSVAELEQK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	QLQSVAELEQK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	QLQSVAELEQK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	QLQSVAELEQK	lung	—	100.0	None	—
E9Q2E4	Hectd4	SLFGGTSGLSSLK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	SLFGGTSGLSSLK	kidney	—	100.0	None	—
E9Q2E4	Hectd4	SLFGGTSGLSSLK	lung	—	100.0	None	—
E9Q2E4	Hectd4	SPDSSNVASSTVGTALPK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	SPDSSNVASSTVGTALPK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	SPDSSNVASSTVGTALPK	lung	—	100.0	None	—
E9Q2E4	Hectd4	TEGTPPPPGQPAK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	TEGTPPPPGQPAK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	TEGTPPPPGQPAK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	TLHQGEDSLLELTK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	TLHQGEDSLLELTK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	TLHQGEDSLLELTK	kidney	—	100.0	None	—
E9Q2E4	Hectd4	TLHQGEDSLLELTK	lung	—	100.0	None	—
E9Q2E4	Hectd4	VSDIYLSK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	VSDIYLSK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	VSDIYLSK	Cerebrum	—	100.0	None	—
E9Q2E4	Hectd4	YLTLEGFHK	BrainStem	—	100.0	None	—
E9Q2E4	Hectd4	YLTLEGFHK	Cerebellum	—	100.0	None	—
E9Q2E4	Hectd4	YLTLEGFHK	Cerebrum	—	100.0	None	—
E9Q2I4	Mideas	ALPFTEK	lung	—	100.0	None	—
E9Q2I4	Mideas	DFFLVQK	lung	—	100.0	None	—
E9Q2I4	Mideas	GDILEALNK	lung	—	100.0	None	—
E9Q2I4	Mideas	GSPHPGVGVPPYYNHPEALK	lung	—	100.0	None	—
E9Q2I4	Mideas	SHEPNAPGSAGIQTSEKPR	lung	—	100.0	None	—
E9Q2I4	Mideas	VPGTDAAAQAEDLNVK	lung	—	100.0	None	—
E9Q2I4	Mideas	VQLEVGRPQAPLNSFHAAK	lung	—	100.0	None	—
E9Q2M9	Wdfy4	AWQHYLASEK	lung	—	100.0	None	—
E9Q2M9	Wdfy4	DASTPVGLPGHSQSFLHSLPALRPSQVTVK	BoneMarrow	—	100.0	None	—
E9Q2M9	Wdfy4	EEGLPSLGDVQHSIQK	lung	—	100.0	None	—
E9Q2M9	Wdfy4	ELDVSVALSGKPSK	lung	—	100.0	None	—
E9Q2M9	Wdfy4	FHQEASGVTVK	lung	—	100.0	None	—

SysQuan Mouse Database

Cart (0)