SysQuan Mouse Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
E9Q0F0	Krt78	AEAEAVFQTK	TailSkin	—	100.0	None	—
E9Q0F0	Krt78	DVDEVFQSK	TailSkin	—	100.0	None	—
E9Q0F0	Krt78	HASVQNDFVVLK	TailSkin	—	100.0	None	—
E9Q0F0	Krt78	IEVDPQFQVVK	TailSkin	—	100.0	None	—
E9Q0F0	Krt78	IEVDPQFQVVK	Thyroid	—	100.0	None	—
E9Q0F0	Krt78	LYEEELGQLK	TailSkin	—	100.0	None	—
E9Q0M9	Cald1	GETENEEFEK	Cerebrum	—	100.0	None	—
E9Q0M9	Cald1	GSVFSAPSASGTPNK	Thyroid	—	100.0	None	—
E9Q0M9	Cald1	LEQYTNAIEGTK	Pancreas	—	100.0	None	—
E9Q0M9	Cald1	LEQYTNAIEGTK	Thyroid	—	100.0	None	—
E9Q0M9	Cald1	PSDLRPGDVSGK	Cerebrum	—	100.0	None	—
E9Q0M9	Cald1	SPAPKPSDLRPGDVSGK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	AASELYIETEK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	AASELYIETEK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	DGDWWTGTVGDK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	DGDWWTGTVGDK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	DNHLNFNK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	DNHLNFNK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	DNHLNFNK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	DSLLTLK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	DSLLTLK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	EDPDWWK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	EDPDWWK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	EDPDWWK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	GEVSGQVGLFPSNYVK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	GEVSGQVGLFPSNYVK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	GEWVDESQTGEPGWLGGELK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	GEWVDESQTGEPGWLGGELK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	GQIINVLNK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	GQIINVLNK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	HDQQFLSLKPIAGFITGDQAR	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	HDQQFLSLKPIAGFITGDQAR	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	IPENEVPTPAKPVTDLTSAPAPK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	IPENEVPTPAKPVTDLTSAPAPK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	IPENEVPTPAKPVTDLTSAPAPK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	ITPTELPK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	ITPTELPK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	ITPTELPK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	KPEIAQVIASYAATGPEQLTLAPGQLILIR	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	KPEIAQVIASYAATGPEQLTLAPGQLILIR	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	KPEIAQVIASYAATGPEQLTLAPGQLILIR	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	LFHPHQEPAK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	LFHPHQEPAK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	LFHPHQEPAK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	LLSPGTSK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	LLSPGTSK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	LLSPGTSK	Cerebrum	—	100.0	None	—
E9Q0N0	Itsn1	LPEEPSSEDEQQPEK	BrainStem	—	100.0	None	—
E9Q0N0	Itsn1	LPEEPSSEDEQQPEK	Cerebellum	—	100.0	None	—
E9Q0N0	Itsn1	LPEEPSSEDEQQPEK	Cerebrum	—	100.0	None	—

SysQuan Mouse Database

Cart (0)