SysQuan Mouse Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
B1AR39	2810408A11Rik	SGSRPELGEDIEDEEQDSPSGLTWVTENPK	Spermatozoa	—	100.0	None	—
B1AR51	Dnah9	AAEETLSWK	lung	—	100.0	None	—
B1AR51	Dnah9	ANLTILFDK	lung	—	100.0	None	—
B1AR51	Dnah9	ESSQALIQGQNPTPK	lung	—	100.0	None	—
B1AR51	Dnah9	FGNFPTTLQK	lung	—	100.0	None	—
B1AR51	Dnah9	LEFVDGHSEPVSDAIDK	lung	—	100.0	None	—
B1AR51	Dnah9	LGTILIQAFDDAPDVEHAFK	lung	—	100.0	None	—
B1AR51	Dnah9	LLDITGTLIK	lung	—	100.0	None	—
B1AR51	Dnah9	LQVVSDTLSFFK	lung	—	100.0	None	—
B1AR51	Dnah9	LSSASGNFLGETALVENLEVTK	lung	—	100.0	None	—
B1AR51	Dnah9	NFHNVSLGQGQEVVAEAALDLAAK	lung	—	100.0	None	—
B1AR51	Dnah9	QLSVNFNPQLISVLK	lung	—	100.0	None	—
B1AR51	Dnah9	RPLVAQDVSQK	lung	—	100.0	None	—
B1AR51	Dnah9	SADLFEVNVPDYK	lung	—	100.0	None	—
B1AR51	Dnah9	SYEQELPETVFK	lung	—	100.0	None	—
B1AR51	Dnah9	TLLPLPVGSEK	lung	—	100.0	None	—
B1AR51	Dnah9	TWVSPIFK	lung	—	100.0	None	—
B1AR51	Dnah9	VELEFWK	lung	—	100.0	None	—
B1AR69	Myh13	DIDDLELTLTK	Trachea	—	100.0	None	—
B1AR69	Myh13	EQYEEEQEGK	Trachea	—	100.0	None	—
B1AR69	Myh13	ESLVSQLTK	Trachea	—	100.0	None	—
B1AR69	Myh13	LEQQTDDLEGSLEQEK	liver	—	100.0	None	—
B1AR69	Myh13	LEQQTDDLEGSLEQEK	lung	—	100.0	None	—
B1AR69	Myh13	LEQQTDDLEGSLEQEK	Muscle	—	100.0	None	—
B1AR69	Myh13	LEQQTDDLEGSLEQEK	SciaticNerve	—	100.0	None	—
B1AR69	Myh13	LEQQTDDLEGSLEQEK	Trachea	—	100.0	None	—
B1AR69	Myh13	LYDQHLGK	Trachea	—	100.0	None	—
B1AR69	Myh13	NLQEEISDLTEQIAETGK	Trachea	—	100.0	None	—
B1AR69	Myh13	SVEDQFNEIK	Trachea	—	100.0	None	—
B1AR69	Myh13	VQLLHSQNTSLINTK	Trachea	—	100.0	None	—
B1AR74	Bcas3	DVVGSGTDTALDVAVK	BrainStem	—	100.0	None	—
B1AR74	Bcas3	DVVGSGTDTALDVAVK	Cerebellum	—	100.0	None	—
B1ART1	Vps13d	EAIFLEVK	Cerebrum	—	100.0	None	—
B1ART1	Vps13d	EFIINDILK	BrainStem	—	100.0	None	—
B1ART1	Vps13d	EFIINDILK	Cerebrum	—	100.0	None	—
B1ART1	Vps13d	EFIINDILK	Heart	—	100.0	None	—
B1ART1	Vps13d	EFIINDILK	kidney	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	BrainStem	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	Cerebellum	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	Cerebrum	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	Heart	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	kidney	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	liver	—	100.0	None	—
B1ART1	Vps13d	ELELPFEVK	lung	—	100.0	None	—
B1ART1	Vps13d	ESVPSASPAGTPK	kidney	—	100.0	None	—
B1ART1	Vps13d	FAGTLSDGLGK	Heart	—	100.0	None	—
B1ART1	Vps13d	FAGTLSDGLGK	lung	—	100.0	None	—
B1ART1	Vps13d	FTTSGEEALIFQTFK	Cerebellum	—	100.0	None	—
B1ART1	Vps13d	FTTSGEEALIFQTFK	kidney	—	100.0	None	—
B1ART1	Vps13d	FTVQIEEK	BrainStem	—	100.0	None	—

SysQuan Mouse Database

Cart (0)