SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P06454	PTMA	SDAAVDTSSEITTK	kidney	—	100.0	MRM	—
P06454	PTMA	SDAAVDTSSEITTK	lung	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	Heart	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	kidney	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	liver	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	Spleen	—	100.0	MRM	—
P06732	CKM	LNYKPEEEYPDLSK	lung	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	kidney	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	liver	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	lung	—	100.0	MRM	—
P06737	PYGL	HLEIIYEINQK	Spleen	—	100.0	MRM	—
P06744	GPI	TFTTQETITNAETAK	liver	—	100.0	MRM	—
P06744	GPI	TFTTQETITNAETAK	lung	—	100.0	MRM	—
P06744	GPI	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	Heart	—	100.0	MRM	—
P06744	GPI	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	kidney	—	100.0	MRM	—
P06753	TPM3	TIDDLEDELYAQK	Heart	—	100.0	MRM	—
P06753	TPM3	TIDDLEDELYAQK	liver	—	100.0	MRM	—
P07195	LDHB	SADTLWDIQK	plasma	—	100.0	MRM	—
P07195	LDHB	SADTLWDIQK	Spleen	—	100.0	MRM	—
P07225	PROS1	QLAVLDK	kidney	—	100.0	MRM	—
P07305	H1-0	LVTTGVLK	Heart	—	100.0	MRM	—
P07305	H1-0	LVTTGVLK	liver	—	100.0	MRM	—
P07305	H1-0	LVTTGVLK	lung	—	100.0	MRM	—
P07305	H1-0	LVTTGVLK	Spleen	—	100.0	MRM	—
P07451	CA3	TILNNGK	liver	—	100.0	MRM	—
P07451	CA3	TILNNGK	plasma	—	100.0	MRM	—
P07741	APRT	AELEIQK	Heart	—	100.0	MRM	—
P07814	EPRS1	AALLNQHYQVNFK	Heart	—	100.0	MRM	—
P07814	EPRS1	AALLNQHYQVNFK	lung	—	100.0	MRM	—
P07814	EPRS1	AALLNQHYQVNFK	Spleen	—	100.0	MRM	—
P08236	GUSB	GFDWPLLVK	Heart	—	100.0	MRM	—
P08236	GUSB	GFDWPLLVK	kidney	—	100.0	MRM	—
P08236	GUSB	GFDWPLLVK	lung	—	100.0	MRM	—
P08236	GUSB	GFDWPLLVK	Spleen	—	100.0	MRM	—
P08238	HSP90AB1	FYEAFSK	lung	—	100.0	MRM	—
P08238	HSP90AB1	FYEAFSK	plasma	—	100.0	MRM	—
P08238	HSP90AB1	FYEAFSK	Spleen	—	100.0	MRM	—
P08238	HSP90AB1	NPDDITQEEYGEFYK	kidney	—	100.0	MRM	—
P08238	HSP90AB1	NPDDITQEEYGEFYK	liver	—	100.0	MRM	—
P08238	HSP90AB1	NPDDITQEEYGEFYK	lung	—	100.0	MRM	—
P08238	HSP90AB1	NPDDITQEEYGEFYK	plasma	—	100.0	MRM	—
P08243	ASNS	EAFSDGITSVK	Spleen	—	100.0	MRM	—
P08263	GSTA1	WLLAAAGVEFEEK	liver	—	100.0	MRM	—
P08263	GSTA1	WLLAAAGVEFEEK	Spleen	—	100.0	MRM	—
P08559	PDHA1	AAASTDYYK	liver	—	100.0	MRM	—
P08559	PDHA1	AAASTDYYK	Spleen	—	100.0	MRM	—
P09210	GSTA2	WLLAAAGVEFEEK	Heart	—	100.0	MRM	—
P09210	GSTA2	WLLAAAGVEFEEK	lung	—	100.0	MRM	—
P09417	QDPR	EGGLLTLAGAK	Heart	—	100.0	MRM	—
P09417	QDPR	EGGLLTLAGAK	liver	—	100.0	MRM	—

SysQuan Core Database

Cart (0)